Structure of PDB 3u5z Chain A Binding Site BS01

Receptor Information

>3u5z Chain A (length=186) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKT
KCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAA
VPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKL
PLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW

Ligand information

>3u5z Chain I (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tttttatgtactcgtagtgtctgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3u5z How a DNA polymerase clamp loader opens a sliding clamp.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	N38 F41 F63 M64 Y108 G109 K110 W111
Binding residue (residue number reindexed from 1)	N37 F40 F62 M63 Y107 G108 K109 W110

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003689	DNA clamp loader activity

	Biological Process
GO:0006260	DNA replication
GO:0039686	bidirectional double-stranded viral DNA replication
GO:0039693	viral DNA genome replication

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3u5z, PDBe:3u5z, PDBj:3u5z
PDBsum	3u5z
PubMed	22194570
UniProt	P04527\|LOADS_BPT4 Sliding-clamp-loader small subunit (Gene Name=62)

[Back to BioLiP]