Structure of PDB 3u58 Chain A Binding Site BS01

Receptor Information
>3u58 Chain A (length=213) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFI
TAQDANNQEINLSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFK
FGDYQIIPKETLGGSGGSTLLISEVLKTSKQYLSVLAQVVDIQSSDKNIR
LKICDNSCNQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQL
KNNIHSSIKESDD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3u58 Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
Resolution2.613 Å
Binding residue
(original residue number in PDB)
Y249 F251 N263 S265 W267 K291 F293 E298 K300
Binding residue
(residue number reindexed from 1)
Y47 F49 N61 S63 W65 K89 F91 E96 K98
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Nov 26 13:18:00 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3u58', asym_id = 'A', bs = 'BS01', title = 'Structural basis for Tetrahymena telomerase proc... binding to single-stranded telomeric-repeat DNA.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3u58', asym_id='A', bs='BS01', title='Structural basis for Tetrahymena telomerase proc... binding to single-stranded telomeric-repeat DNA.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676', uniprot = '', pdbid = '3u58', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676', uniprot='', pdbid='3u58', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>