Structure of PDB 3u4w Chain A Binding Site BS01

Receptor Information
>3u4w Chain A (length=275) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFL
QEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYL
RLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLA
RLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTK
GRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPT
FEYLQAFLEDYFTSTEPQYQPGENL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3u4w Highly specific, bisubstrate-competitive Src inhibitors from DNA-templated macrocycles.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Q275 G276 C277 F278 G279 E280 V281 A293 K295 L297 M341 R388 L393 D404 A408 I411
Binding residue
(residue number reindexed from 1)		Q17 G18 C19 F20 G21 E22 V23 A35 K37 L39 M83 R130 L135 D146 A150 I153
Enzymatic activity
Catalytic site (original residue number in PDB) D386 R388 A390 N391 D404 F424
Catalytic site (residue number reindexed from 1) D128 R130 A132 N133 D146 F166
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0005524 ATP binding
Biological Process
GO:0006468 protein phosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3u4w, PDBe:3u4w, PDBj:3u4w
PDBsum3u4w
PubMed22344177
UniProtP00523|SRC_CHICK Proto-oncogene tyrosine-protein kinase Src (Gene Name=SRC)

[Back to BioLiP]