Structure of PDB 3u3y Chain A Binding Site BS01

Receptor Information

>3u3y Chain A (length=215) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LPHGHMQTLIFLDLEATGLPSSRPEVTELCLLAVHRRALEQGHPPPVPRP
PRVVDKLSLCIAPGKACSPGASEITGLSKAELEVQGRQRFDDNLAILLRA
FLQRQPQPCCLVAHNGDRYDFPLLQTELARLSTPSPLDGTFCVDSIAALK
ALEQRKSYSLGSIYTRLYWQAPTDSHTAEGHVLTLLSICQWKPQALLQWV
DEHARPFSTVKPMYG

Ligand information

>3u3y Chain C (length=4) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gacg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3u3y Defects in DNA degradation revealed in crystal structures of TREX1 exonuclease mutations linked to autoimmune disease.
Resolution	2.28 Å
Binding residue (original residue number in PDB)	E20 A21 G23 L24 P25 A81 I84 H124 N125 R128 Y129 S176 Y177 S178 L179 H200
Binding residue (residue number reindexed from 1)	E15 A16 G18 L19 P20 A71 I74 H114 N115 R118 Y119 S157 Y158 S159 L160 H181

Enzymatic activity

Enzyme Commision number

3.1.11.2: exodeoxyribonuclease III.

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003676	nucleic acid binding
GO:0003677	DNA binding
GO:0003690	double-stranded DNA binding
GO:0003697	single-stranded DNA binding
GO:0004527	exonuclease activity
GO:0005515	protein binding
GO:0008296	3'-5'-DNA exonuclease activity
GO:0008301	DNA binding, bending
GO:0008311	double-stranded DNA 3'-5' DNA exonuclease activity
GO:0008408	3'-5' exonuclease activity
GO:0032405	MutLalpha complex binding
GO:0032407	MutSalpha complex binding
GO:0032558	adenyl deoxyribonucleotide binding
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:0050699	WW domain binding

	Biological Process
GO:0000077	DNA damage checkpoint signaling
GO:0001568	blood vessel development
GO:0001822	kidney development
GO:0002250	adaptive immune response
GO:0002251	organ or tissue specific immune response
GO:0002253	activation of immune response
GO:0002281	macrophage activation involved in immune response
GO:0002320	lymphoid progenitor cell differentiation
GO:0002383	immune response in brain or nervous system
GO:0002437	inflammatory response to antigenic stimulus
GO:0002457	T cell antigen processing and presentation
GO:0002637	regulation of immunoglobulin production
GO:0003007	heart morphogenesis
GO:0003015	heart process
GO:0003228	atrial cardiac muscle tissue development
GO:0006091	generation of precursor metabolites and energy
GO:0006110	regulation of glycolytic process
GO:0006259	DNA metabolic process
GO:0006260	DNA replication
GO:0006304	DNA modification
GO:0006308	DNA catabolic process
GO:0006954	inflammatory response
GO:0006955	immune response
GO:0006974	DNA damage response
GO:0008340	determination of adult lifespan
GO:0009411	response to UV
GO:0010468	regulation of gene expression
GO:0019217	regulation of fatty acid metabolic process
GO:0031571	mitotic G1 DNA damage checkpoint signaling
GO:0032197	retrotransposition
GO:0032479	regulation of type I interferon production
GO:0032508	DNA duplex unwinding
GO:0032680	regulation of tumor necrosis factor production
GO:0034599	cellular response to oxidative stress
GO:0034614	cellular response to reactive oxygen species
GO:0034644	cellular response to UV
GO:0035458	cellular response to interferon-beta
GO:0035781	CD86 biosynthetic process
GO:0043277	apoptotic cell clearance
GO:0043457	regulation of cellular respiration
GO:0045087	innate immune response
GO:0045088	regulation of innate immune response
GO:0045184	establishment of protein localization
GO:0045824	negative regulation of innate immune response
GO:0046890	regulation of lipid biosynthetic process
GO:0050727	regulation of inflammatory response
GO:0050821	protein stabilization
GO:0050863	regulation of T cell activation
GO:0051607	defense response to virus
GO:0060337	type I interferon-mediated signaling pathway
GO:0060339	negative regulation of type I interferon-mediated signaling pathway
GO:0061635	regulation of protein complex stability
GO:0071357	cellular response to type I interferon
GO:0071480	cellular response to gamma radiation
GO:0072711	cellular response to hydroxyurea
GO:0097281	immune complex formation
GO:0160049	negative regulation of cGAS/STING signaling pathway
GO:1904161	DNA synthesis involved in UV-damage excision repair
GO:1905671	regulation of lysosome organization

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005829	cytosol
GO:0008250	oligosaccharyltransferase complex
GO:0016020	membrane
GO:0032993	protein-DNA complex
GO:0043596	nuclear replication fork

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3u3y, PDBe:3u3y, PDBj:3u3y
PDBsum	3u3y
PubMed	22071149
UniProt	Q91XB0\|TREX1_MOUSE Three-prime repair exonuclease 1 (Gene Name=Trex1)

[Back to BioLiP]