Structure of PDB 3u2e Chain A Binding Site BS01

Receptor Information
>3u2e Chain A (length=260) Species: 190650 (Caulobacter vibrioides CB15) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRLALEADLRGAIGRGEITPYFQPIVRLSTGALSGFEALARWIHPRRGML
PPDEFLPLIEEMGLMSELGAHMMHAAAQQLSTWRAAHPAMGNLTVSVNLS
TGEIDRPGLVADVAETLRVNRLPRGALKLEVTESDIMRDPERAAVILKTL
RDAGAGLALDDFGTGFSSLSYLTRLPFDTLKIDRYFVRTMGNNAGSAKIV
RSVVKLGQDLDLEVVAEGVENAEMAHALQSLGCDYGQGFGYAPALSPQEA
EVYLNEAYVD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3u2e EAL domain from Caulobacter crescentus in complex with 5'-pGpG and Mg++
Resolution2.32 Å
Binding residue
(original residue number in PDB)		Q309 L325 A326 R327 P338 L342 M358 N384 S386 D446 D447 R470 E503 E506 G524 F525
Binding residue
(residue number reindexed from 1)		Q23 L39 A40 R41 P52 L56 M72 N98 S100 D160 D161 R184 E217 E220 G238 F239
Enzymatic activity
Enzyme Commision number ?
External links