Structure of PDB 3u23 Chain A Binding Site BS01

Receptor Information
>3u23 Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQCKVLFEYIPQNEDELELKVGDIIDINEEVEEGWWSGTLNNKLGLFPSN
FVKELE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3u23 Differential Recognition Preferences of the Three Src Homology 3 (SH3) Domains from the Adaptor CD2-associated Protein (CD2AP) and Direct Association with Ras and Rab Interactor 3 (RIN3).
Resolution1.11 Å
Binding residue
(original residue number in PDB)		F117 D125 E126 E142 W145 L156 N160 F161
Binding residue
(residue number reindexed from 1)		F7 D15 E16 E32 W35 L46 N50 F51
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3u23, PDBe:3u23, PDBj:3u23
PDBsum3u23
PubMed26296892
UniProtQ9Y5K6|CD2AP_HUMAN CD2-associated protein (Gene Name=CD2AP)

[Back to BioLiP]