Structure of PDB 3tzd Chain A Binding Site BS01

Receptor Information
>3tzd Chain A (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LYFQGEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELI
EAFLNSQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tzd Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
Resolution1.81 Å
Binding residue
(original residue number in PDB)		F26 G28 E29 F30 V31 V32 W51 F54 E62 N66 D68 L72
Binding residue
(residue number reindexed from 1)		F3 G5 E6 F7 V8 V9 W28 F31 E39 N43 D45 L49
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3tzd, PDBe:3tzd, PDBj:3tzd
PDBsum3tzd
PubMed22514736
UniProtQ13185|CBX3_HUMAN Chromobox protein homolog 3 (Gene Name=CBX3)

[Back to BioLiP]