Structure of PDB 3tz1 Chain A Binding Site BS01

Receptor Information
>3tz1 Chain A (length=71) Species: 6571 (Chlamys nipponensis akazara) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDERELKEAFRVLDKEKKGVIKVDVLRWILKSLGDELTEDEIENMIAETD
TDGSGTVDYEEFKCLMMSSDA
Ligand information
>3tz1 Chain B (length=24) Species: 6571 (Chlamys nipponensis akazara) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GLSPEKKKMLKKLIMQKAAEDLAN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tz1 Structure of the Ca2+-saturated C-terminal domain of scallop troponin C in complex with a troponin I fragment
Resolution1.8 Å
Binding residue
(original residue number in PDB)		V93 L94 K96 I110 E122 M126 E129 F143 L146 M147 S149 D151
Binding residue
(residue number reindexed from 1)		V12 L13 K15 I29 E41 M45 E48 F62 L65 M66 S68 D70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:3tz1, PDBe:3tz1, PDBj:3tz1
PDBsum3tz1
PubMed23096565
UniProtQ27428

[Back to BioLiP]