Structure of PDB 3twh Chain A Binding Site BS01

Receptor Information
>3twh Chain A (length=134) Species: 86665 (Halalkalibacterium halodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEF
LAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWK
LVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3twh Novel complex MAD phasing and RNase H structural insights using selenium oligonucleotides.
Resolution1.79 Å
Binding residue
(original residue number in PDB)		D71 V72 G73 S74 G76 N105 E109 N132 Q134 K180 T183
Binding residue
(residue number reindexed from 1)		D11 V12 G13 S14 G16 N45 E49 N72 Q74 K120 T123
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:3twh, PDBe:3twh, PDBj:3twh
PDBsum3twh
PubMed24531469
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]