Structure of PDB 3ts8 Chain A Binding Site BS01

Receptor Information
>3ts8 Chain A (length=234) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFVQLAKTVPV
QLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQH
LIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCM
GGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKT
MDGEYFTLQIRGRERFEQFRERNEALELKDAQAT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ts8 Crystal Structure of a Multidomain Human p53 Tetramer Bound to the Natural CDKN1A (p21) p53-Response Element.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		S241 R273 C275 A276 R280
Binding residue
(residue number reindexed from 1)		S148 R180 C182 A183 R187
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0051262 protein tetramerization
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ts8, PDBe:3ts8, PDBj:3ts8
PDBsum3ts8
PubMed21933903
UniProtP04637|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53)

[Back to BioLiP]