Structure of PDB 3tq6 Chain A Binding Site BS01

Receptor Information
>3tq6 Chain A (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tq6 Human mitochondrial transcription factor A induces a U-turn structure in the light strand promoter.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
V54 L58 K62 L65 K69 T77 I81 K146 T150 R157 Y162 Q179 L182 K186 W189 Y211 R232 R233 T234 K236
Binding residue
(residue number reindexed from 1)
V11 L15 K19 L22 K26 T34 I38 K103 T107 R114 Y119 Q136 L139 K143 W146 Y168 R189 R190 T191 K193
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3tq6, PDBe:3tq6, PDBj:3tq6
PDBsum3tq6
PubMed22037172
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]