Structure of PDB 3tl0 Chain A Binding Site BS01

Receptor Information
>3tl0 Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHI
KIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tl0 Simultaneous binding of two peptidyl ligands by a SRC homology 2 domain.
Resolution2.05 Å
Binding residue
(original residue number in PDB)
G13 E17 R32 S34 K35 S36 T52 H53 K55 K89 E90 K91
Binding residue
(residue number reindexed from 1)
G9 E13 R28 S30 K31 S32 T48 H49 K51 K85 E86 K87
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:3tl0, PDBe:3tl0, PDBj:3tl0
PDBsum3tl0
PubMed21800896
UniProtQ06124|PTN11_HUMAN Tyrosine-protein phosphatase non-receptor type 11 (Gene Name=PTPN11)

[Back to BioLiP]