Structure of PDB 3tjh Chain A Binding Site BS01

Receptor Information
>3tjh Chain A (length=175) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVP
WMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYG
CDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQA
GAAEYYRAYLEGECVEWLHRYLKNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tjh T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
Resolution2.12 Å
Binding residue
(original residue number in PDB)
Y7 R62 I63 V66 Q70 W73 V76 N77 Y84 R97 Y99 Y123 T143 K146 W147 A150 A152 Y155 Y156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 R62 I63 V66 Q70 W73 V76 N77 Y84 R97 Y99 Y123 T143 K146 W147 A150 A152 Y155 Y156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3tjh, PDBe:3tjh, PDBj:3tjh
PDBsum3tjh
PubMed22101157
UniProtP01897|HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain (Gene Name=H2-L)

[Back to BioLiP]