Structure of PDB 3tj6 Chain A Binding Site BS01

Receptor Information
>3tj6 Chain A (length=253) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPVFHTRTIESILEPVAQQISHLVIMHEEGKAIPDLTAPVAAVQAAVSNL
VRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPA
RDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETM
EDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPV
LISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
EDA
Ligand information
>3tj6 Chain B (length=23) Species: 452659 (Rickettsia rickettsii str. Iowa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDIYNKAREVINAVNPVIEALEK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tj6 The rickettsia surface cell antigen 4 applies mimicry to bind to and activate vinculin.
Resolution2.76 Å
Binding residue
(original residue number in PDB)		I12 Q19 H22 L23 M26 V47 A50 L54 V57 I115 L123 F126 D127
Binding residue
(residue number reindexed from 1)		I12 Q19 H22 L23 M26 V43 A46 L50 V53 I111 L119 F122 D123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005198 structural molecule activity
GO:0051015 actin filament binding
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0015629 actin cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3tj6, PDBe:3tj6, PDBj:3tj6
PDBsum3tj6
PubMed21841197
UniProtP18206|VINC_HUMAN Vinculin (Gene Name=VCL)

[Back to BioLiP]