Structure of PDB 3thk Chain A Binding Site BS01

Receptor Information
>3thk Chain A (length=58) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPA
AYVKKLDP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3thk High-Resolution Crystal Structure of Spectrin SH3 Domain Fused with a Proline-Rich Peptide.
Resolution1.7 Å
Binding residue
(original residue number in PDB)
Y12 Y14 D39 W40 P53 Y56
Binding residue
(residue number reindexed from 1)
Y8 Y10 D35 W36 P49 Y52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3thk, PDBe:3thk, PDBj:3thk
PDBsum3thk
PubMed22066535
UniProtP16086|SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 (Gene Name=Sptan1)

[Back to BioLiP]