Structure of PDB 3tfk Chain A Binding Site BS01

Receptor Information
>3tfk Chain A (length=174) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPW
MEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGC
DVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAG
AAEYYRAYLEGECVEWLHRYLKNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tfk T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
Resolution2.753 Å
Binding residue
(original residue number in PDB)
R62 V66 Q70 W73 N77 Y84 R97 Y99 T143 K146 W147 A152 Y155 Y159 E163 W167
Binding residue
(residue number reindexed from 1)
R61 V65 Q69 W72 N76 Y83 R96 Y98 T142 K145 W146 A151 Y154 Y158 E162 W166
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3tfk, PDBe:3tfk, PDBj:3tfk
PDBsum3tfk
PubMed22101157
UniProtP01897|HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain (Gene Name=H2-L)

[Back to BioLiP]