Structure of PDB 3tdz Chain A Binding Site BS01

Receptor Information
>3tdz Chain A (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFR
AATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQF
TFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPK
DTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tdz N-terminal acetylation acts as an avidity enhancer within an interconnected multiprotein complex.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
I83 D84 P97 V102 L103 Q114 C115 F164 M177 Y181
Binding residue
(residue number reindexed from 1)
I23 D24 P37 V42 L43 Q54 C55 F104 M117 Y121
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3tdz, PDBe:3tdz, PDBj:3tdz
PDBsum3tdz
PubMed21940857
UniProtQ96GG9|DCNL1_HUMAN DCN1-like protein 1 (Gene Name=DCUN1D1)

[Back to BioLiP]