Structure of PDB 3tbw Chain A Binding Site BS01

Receptor Information
>3tbw Chain A (length=274) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVT
LRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVP
LGKEQNYTCRVYHEGLPEPLTLRW
Ligand information
>3tbw Chain I (length=9) Species: 11627 (Lymphocytic choriomeningitis virus (strain WE)) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGPSNFATM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3tbw Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
Resolution2.15 Å
Binding residue
(original residue number in PDB)		M5 Y7 E9 E63 K66 Q70 W73 S77 L81 Y84 L95 Q97 S99 F116 T143 K146 W147 H155 Y156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		M5 Y7 E9 E63 K66 Q70 W73 S77 L81 Y84 L95 Q97 S99 F116 T143 K146 W147 H155 Y156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3tbw, PDBe:3tbw, PDBj:3tbw
PDBsum3tbw
PubMed
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]