Structure of PDB 3t1u Chain A Binding Site BS01

Receptor Information
>3t1u Chain A (length=163) Species: 322710 (Azotobacter vinelandii DJ) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SIKLQTNHGTITLKLFADKAPETAANFEQYVKDGHYDGTIFHRVIDGFMI
QGGGFEPGMKQKSTRAPIKNEANNGLSNKKYTIAMARTPDPHSASAQFFI
NVKDNAFLDHTAPTAHGWGYAVFGEVVEGTDVVDRIKSVATGSRAGHGDV
PVDDVIIEKAEIV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3t1u Structure of a bacterial cytoplasmic cyclophilin A in complex with a tetrapeptide.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		R43 F48 A86 R87 P89 Q97 F99 Y120
Binding residue
(residue number reindexed from 1)		R43 F48 A86 R87 P89 Q97 F99 Y120
Enzymatic activity
Catalytic site (original residue number in PDB) R43 F48 Q51 R87 F99 L108 Y120
Catalytic site (residue number reindexed from 1) R43 F48 Q51 R87 F99 L108 Y120
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
Biological Process
GO:0000413 protein peptidyl-prolyl isomerization
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3t1u, PDBe:3t1u, PDBj:3t1u
PDBsum3t1u
PubMed22442217
UniProtC1DHE4

[Back to BioLiP]