Structure of PDB 3sxu Chain A Binding Site BS01

Receptor Information
>3sxu Chain A (length=146) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYR
LDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRT
SFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3sxu Structure of the SSB-DNA polymerase III interface and its role in DNA replication.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		V117 R128 Y131 K132
Binding residue
(residue number reindexed from 1)		V116 R127 Y130 K131
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0009314 response to radiation
GO:0032298 positive regulation of DNA-templated DNA replication initiation
GO:0071897 DNA biosynthetic process
Cellular Component
GO:0009360 DNA polymerase III complex
GO:0030894 replisome
GO:0043846 DNA polymerase III, clamp loader complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3sxu, PDBe:3sxu, PDBj:3sxu
PDBsum3sxu
PubMed21857649
UniProtP28905|HOLC_ECOLI DNA polymerase III subunit chi (Gene Name=holC)

[Back to BioLiP]