Structure of PDB 3ssc Chain A Binding Site BS01

Receptor Information
>3ssc Chain A (length=154) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWFA
FLGEGQEASNGIYPVILYYKDFDELVLAYGISDTNEPHAQWQFSSDIPKT
IAEYFQATSGVYPKKYGQSYYACSQKVSQGIDYTRFASMLDNIINDYKLI
FNSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ssc The recognition domain of the methyl-specific endonuclease McrBC flips out 5-methylcytosine.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
S20 Q21 S22 T23 K24 Y41 G42 N43
Binding residue
(residue number reindexed from 1)
S19 Q20 S21 T22 K23 Y40 G41 N42
Enzymatic activity
Enzyme Commision number 3.1.21.-
External links
PDB RCSB:3ssc, PDBe:3ssc, PDBj:3ssc
PDBsum3ssc
PubMed22570415
UniProtP15005|MCRB_ECOLI Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Gene Name=mcrB)

[Back to BioLiP]