Structure of PDB 3spd Chain A Binding Site BS01

Receptor Information

>3spd Chain A (length=200) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFRDNLKVYIESPESYKNVIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLT
HVHPLEIMMKHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALANY
IKVGFHAGPSMNNLHLHIMTLDHVSPSLKNSAHYISFTSPFFVKIDTPTS
NLPTRGTLTSLFQEDLKCWRCGETFGRHFTKLKAHLQEEYDDWLDKSVSM

Ligand information

>3spd Chain E (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tattccgatagtga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3spd Crystal structures of aprataxin ortholog Hnt3 reveal the mechanism for reversal of 5'-adenylated DNA
Resolution	1.912 Å
Binding residue (original residue number in PDB)	F34 F65 K67 P141 S142 A164 H165 T191 F194
Binding residue (residue number reindexed from 1)	F2 F33 K35 P109 S110 A132 H133 T159 F162

Enzymatic activity

Enzyme Commision number

3.6.1.71: adenosine-5'-diphospho-5'-[DNA] diphosphatase.
3.6.1.72: DNA-3'-diphospho-5'-guanosine diphosphatase.

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity

View graph for
Molecular Function

External links

PDB	RCSB:3spd, PDBe:3spd, PDBj:3spd
PDBsum	3spd
PubMed	21984208
UniProt	O74859\|APTX_SCHPO Aprataxin-like protein (Gene Name=hnt3)

[Back to BioLiP]