Structure of PDB 3sp6 Chain A Binding Site BS01

Receptor Information

>3sp6 Chain A (length=270) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDME
TLCMAEKTLVAKLVANNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFA
NLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLR
KPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIE
KMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIK
KTESDAALHPLLQEIYRDMY

Ligand information

>3sp6 Chain B (length=11) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LSLLQKLLLAT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3sp6 Structural basis for iloprost as a dual peroxisome proliferator-activated receptor alpha/delta agonist.
Resolution	2.21 Å
Binding residue (original residue number in PDB)	K292 Q305 V306 L309 P458 L459 E462
Binding residue (residue number reindexed from 1)	K94 Q107 V108 L111 P260 L261 E264

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003824	catalytic activity
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3sp6, PDBe:3sp6, PDBj:3sp6
PDBsum	3sp6
PubMed	21775429
UniProt	Q07869\|PPARA_HUMAN Peroxisome proliferator-activated receptor alpha (Gene Name=PPARA)

[Back to BioLiP]