Structure of PDB 3so6 Chain A Binding Site BS01

Receptor Information
>3so6 Chain A (length=137) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEGMVFSLKYLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKV
SPRGIILTDSLTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESLE
CHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSLVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3so6 Atomic structure of the autosomal recessive hypercholesterolemia phosphotyrosine-binding domain in complex with the LDL-receptor tail.
Resolution1.37 Å
Binding residue
(original residue number in PDB)
K61 E63 Y113 R114 I115 S116 Y117 C118 T119 A120 Q133 Q154 T157 A161 F164 F168 W171
Binding residue
(residue number reindexed from 1)
K20 E22 Y72 R73 I74 S75 Y76 C77 T78 A79 Q92 Q113 T116 A120 F123 F127 W130
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3so6, PDBe:3so6, PDBj:3so6
PDBsum3so6
PubMed22509010
UniProtD3ZAR1|ARH_RAT Low density lipoprotein receptor adapter protein 1 (Gene Name=Ldlrap1)

[Back to BioLiP]