Structure of PDB 3sm1 Chain A Binding Site BS01

Receptor Information
>3sm1 Chain A (length=113) Species: 114654 (DG-75 Murine leukemia virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPPPEPRITLKVGGQPVTFLVDTGAQHSVLTQNPGPLSDKSAWVQGATGG
KRYRWTTDRKVHLATGKVTHSFLHVPDCPYPLLGRDLLTKLKAQIHFEGS
GAQVVGPMGQPLQ
Ligand information
>3sm1 Chain M (length=4) Species: 285516 (Streptomyces argenteolus subsp. toyonakensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VVVL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3sm1 Structural and biochemical characterization of the inhibitor complexes of xenotropic murine leukemia virus-related virus protease.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		G34 Q36 H37 W53 V54 Q55 W65
Binding residue
(residue number reindexed from 1)		G24 Q26 H27 W43 V44 Q45 W55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3sm1, PDBe:3sm1, PDBj:3sm1
PDBsum3sm1
PubMed21951660
UniProtQ9E7M1

[Back to BioLiP]