Structure of PDB 3si5 Chain A Binding Site BS01

Receptor Information
>3si5 Chain A (length=152) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TGSQQKRAFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLE
RAVEALQGEKRYYSDPRFLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQ
FYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQHRQFQARVSRQ
TL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3si5 Structure of a Blinkin-BUBR1 Complex Reveals an Interaction Crucial for Kinetochore-Mitotic Checkpoint Regulation via an Unanticipated Binding Site.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		E103 V106 E107 L131 C132 N133 D137 M138 Y141
Binding residue
(residue number reindexed from 1)		E50 V53 E54 L78 C79 N80 D84 M85 Y88
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Biological Process
GO:0007094 mitotic spindle assembly checkpoint signaling

View graph for
Biological Process
External links
PDB RCSB:3si5, PDBe:3si5, PDBj:3si5
PDBsum3si5
PubMed22000412
UniProtO60566|BUB1B_HUMAN Mitotic checkpoint serine/threonine-protein kinase BUB1 beta (Gene Name=BUB1B)

[Back to BioLiP]