Structure of PDB 3shb Chain A Binding Site BS01

Receptor Information
>3shb Chain A (length=67) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDP
PLSSVPSEDEWYCPECR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3shb Crystal structure of PHD domain of UHRF1 and insights into recognition of unmodified histone H3 arginine residue 2.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		C329 P340 D341 Q343 L344 M345 C346 D347 D350 E368 D369
Binding residue
(residue number reindexed from 1)		C19 P30 D31 Q33 L34 M35 C36 D37 D40 E58 D59
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:3shb, PDBe:3shb, PDBj:3shb
PDBsum3shb
PubMed21808300
UniProtQ96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 (Gene Name=UHRF1)

[Back to BioLiP]