Structure of PDB 3sfj Chain A Binding Site BS01

Receptor Information
>3sfj Chain A (length=103) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTR
VSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLV
TRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3sfj A CAL Inhibitor with Single-PDZ Specificity Rescues deltaF508-CFTR
Resolution1.24 Å
Binding residue
(original residue number in PDB)		I29 L30 F32 S33 I34 G35 G36 Q40 D41 Q44 N45 T59 H91 T99
Binding residue
(residue number reindexed from 1)		I19 L20 F22 S23 I24 G25 G26 Q30 D31 Q34 N35 T49 H81 T89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3sfj, PDBe:3sfj, PDBj:3sfj
PDBsum3sfj
PubMed
UniProtO14907|TX1B3_HUMAN Tax1-binding protein 3 (Gene Name=TAX1BP3)

[Back to BioLiP]