Structure of PDB 3sem Chain A Binding Site BS01

Receptor Information
>3sem Chain A (length=58) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFP
SNYVCPYN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3sem Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F163 Q168 E169 E172 N190 W191 P204 N206 Y207
Binding residue
(residue number reindexed from 1)		F9 Q14 E15 E18 N36 W37 P50 N52 Y53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3sem, PDBe:3sem, PDBj:3sem
PDBsum3sem
PubMed9851931
UniProtP29355|SEM5_CAEEL Sex muscle abnormal protein 5 (Gene Name=sem-5)

[Back to BioLiP]