Structure of PDB 3s9s Chain A Binding Site BS01

Receptor Information

>3s9s Chain A (length=258) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SADLRALAKHLYDSYIKSFPLTKAKARAILTGKSPFVIYDMNSLMMGEDK
IKFKHITKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTL
LKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPK
FEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQAL
ELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETMSLHPL
LQEIYKDL

Ligand information

>3s9s Chain B (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RHKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3s9s Discovery of GSK1997132B a novel centrally penetrant benzimidazole PPARgamma partial agonist.
Resolution	2.55 Å
Binding residue (original residue number in PDB)	T297 V315 L318 K319 E471
Binding residue (residue number reindexed from 1)	T80 V98 L101 K102 E253

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3s9s, PDBe:3s9s, PDBj:3s9s
PDBsum	3s9s
PubMed	21798739
UniProt	P37231\|PPARG_HUMAN Peroxisome proliferator-activated receptor gamma (Gene Name=PPARG)

[Back to BioLiP]