Structure of PDB 3s9c Chain A Binding Site BS01

Receptor Information
>3s9c Chain A (length=234) Species: 343250 (Daboia siamensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVGGDECNINEHPFLVALYTSASSTIHCAGALINREWVLTAAHCDRRNIR
IKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTY
STHIAPVSLPSRSRGVGSRCRIMGWGKISTTTYPDVPHCTNIFIVKHKWC
EPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGEMHGIVAGGSEP
CGQHLKPAVYTKVFDYNNWIQSIIAGNRTVTCPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3s9c Structural basis of coagulation factor V recognition for cleavage by RVV-V
Resolution1.8 Å
Binding residue
(original residue number in PDB)		H57 L99 Y172 W173 D189 T190 C191 S195 G215 G216 S217 E218 C220 V227
Binding residue
(residue number reindexed from 1)		H43 L85 Y154 W156 D174 T175 C176 S180 G196 G197 S198 E199 C201 V209
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 H192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H43 D88 H177 G178 D179 S180 G181
Enzyme Commision number 3.4.21.95: snake venom factor V activator.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
GO:0090729 toxin activity
Biological Process
GO:0006508 proteolysis
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3s9c, PDBe:3s9c, PDBj:3s9c
PDBsum3s9c
PubMed21871889
UniProtP18965|VSPG_DABSI Factor V activator RVV-V gamma

[Back to BioLiP]