Structure of PDB 3s5a Chain A Binding Site BS01

Receptor Information

>3s5a Chain A (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGK
WHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFN
FVLINRYKDGSDHICEHRDDERELAPGSPIASVSFGASRDFVFRHKDSRG
KSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFR
KILL

Ligand information

>3s5a Chain B (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ctgtctcactgtcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3s5a Duplex interrogation by a direct DNA repair protein in search of base damage
Resolution	1.7 Å
Binding residue (original residue number in PDB)	V101 F102 H106 P109 R110 H167 C169 R172 Y235
Binding residue (residue number reindexed from 1)	V47 F48 H52 P55 R56 H113 C115 R118 Y181

Enzymatic activity

Enzyme Commision number

1.14.11.33: DNA oxidative demethylase.

Gene Ontology

	Biological Process
GO:0006281	DNA repair

View graph for
Biological Process

External links

PDB	RCSB:3s5a, PDBe:3s5a, PDBj:3s5a
PDBsum	3s5a
PubMed	22659876
UniProt	Q6NS38\|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 (Gene Name=ALKBH2)

[Back to BioLiP]