Structure of PDB 3s4s Chain A Binding Site BS01

Receptor Information
>3s4s Chain A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKQWEF
Ligand information
>3s4s Chain C (length=13) Species: 83928 (Influenza A virus (A/Swine/Netherlands/L2/93(H3N2))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKYVKQNTLKLAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3s4s Affinity maturation of human CD4 by yeast surface display and crystal structure of a CD4-HLA-DR1 complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Q9 W43 F51 A52 S53 F54 G58 N62 V65 N69 I72 M73
Binding residue
(residue number reindexed from 1)		Q7 W41 F49 A50 S51 F52 G56 N60 V63 N67 I70 M71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3s4s, PDBe:3s4s, PDBj:3s4s
PDBsum3s4s
PubMed21900604
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]