Structure of PDB 3s04 Chain A Binding Site BS01

Receptor Information
>3s04 Chain A (length=209) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FIYEPFQIPSGSMMPTLLIGDFILVEKFAHPKRGDIVVFKYPEDPKLDYI
KRAVGLPGDKVTYDPVSKELTIQPGCSACENALPVTYSNVEPSDFVQTFT
SGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPG
QQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDL
RLSRIGGIH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3s04 Synthesis and characterization of the arylomycin lipoglycopeptide antibiotics and the crystallographic analysis of their complex with signal peptidase.
Resolution2.44 Å
Binding residue
(original residue number in PDB)		F85 Q86 P88 D143 Y144 I145 K146
Binding residue
(residue number reindexed from 1)		F6 Q7 P9 D48 Y49 I50 K51
Enzymatic activity
Catalytic site (original residue number in PDB) S89 S91 K146 S279
Catalytic site (residue number reindexed from 1) S10 S12 K51 S173
Enzyme Commision number 3.4.21.89: signal peptidase I.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006465 signal peptide processing
GO:0006508 proteolysis
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3s04, PDBe:3s04, PDBj:3s04
PDBsum3s04
PubMed21999324
UniProtP00803|LEP_ECOLI Signal peptidase I (Gene Name=lepB)

[Back to BioLiP]