Structure of PDB 3rzm Chain A Binding Site BS01

Receptor Information
>3rzm Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGK
WHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFN
FVLINRYKDGSDHICEHRDDERELAPGSPIASVSFGASRDFVFRHKDSRR
VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rzm Duplex interrogation by a direct DNA repair protein in search of base damage
Resolution3.06 Å
Binding residue
(original residue number in PDB)		V101 F102 H106 P109 R110 F124 S125 H167 I168 C169 E170 H171 Y235 R254
Binding residue
(residue number reindexed from 1)		V47 F48 H52 P55 R56 F70 S71 H113 I114 C115 E116 H117 Y175 R194
Enzymatic activity
Enzyme Commision number 1.14.11.33: DNA oxidative demethylase.
Gene Ontology

View graph for
Biological Process
External links
PDB RCSB:3rzm, PDBe:3rzm, PDBj:3rzm
PDBsum3rzm
PubMed22659876
UniProtQ6NS38|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 (Gene Name=ALKBH2)

[Back to BioLiP]