Structure of PDB 3rwj Chain A Binding Site BS01

Receptor Information
>3rwj Chain A (length=276) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMKYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAESPREEPRAP
WVEQEGPEYWEEATRRAKEAAQTHRENLRTALRYYNQSEAGSHTIQKMYG
CDLGPDGRLLRGYHQSAYDGKDYIALNGDLRSWTAADMAAQNTQRKWEGN
RYAERFRAYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEEQTQDTEFVETRPGGDGTFQKWGAVVVP
SGEEQRYTCHVQHEGLPEPLTLRWEP
Ligand information
>3rwj Chain C (length=8) Species: 11723 (Simian immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HLEVQGYW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rwj Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y7 Y9 E45 R66 T73 E76 N77 Y84 I95 Y99 Y118 Y123 T143 K146 W147 Y152 R155 F156 Y159
Binding residue
(residue number reindexed from 1)		Y7 Y9 E45 R66 T73 E76 N77 Y84 I95 Y99 Y118 Y123 T143 K146 W147 Y152 R155 F156 Y159
Enzymatic activity
Enzyme Commision number ?
External links