Structure of PDB 3rwf Chain A Binding Site BS01

Receptor Information
>3rwf Chain A (length=276) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMKYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAESPREEPRAP
WVEQEGPEYWEEATRRAKEAAQTHRENLRTALRYYNQSEAGSHTIQKMYG
CDLGPDGRLLRGYHQSAYDGKDYIALNGDLRSWTAADMAAQNTQRKWEGN
RYAERFRAYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEEQTQDTEFVETRPGGDGTFQKWGAVVVP
SGEEQRYTCHVQHEGLPEPLTLRWEP
Ligand information
>3rwf Chain C (length=9) Species: 11723 (Simian immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QTSQWDDPW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rwf Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y7 Y9 A63 R66 H74 N77 T80 Y84 I95 K97 Y99 Y123 T143 K146 W147 Y152 R155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y9 A63 R66 H74 N77 T80 Y84 I95 K97 Y99 Y123 T143 K146 W147 Y152 R155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links