Structure of PDB 3rwd Chain A Binding Site BS01

Receptor Information
>3rwd Chain A (length=276) Species: 9544 (Macaca mulatta) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMKYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAESPREEPRAP
WVEQEGPEYWEEATRRAKEAAQTHRENLRTALRYYNQSEAGSHTIQKMYG
CDLGPDGRLLRGYHQSAYDGKDYIALNGDLRSWTAADMAAQNTQRKWEGN
RYAERFRAYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEEQTQDTEFVETRPGGDGTFQKWGAVVVP
SGEEQRYTCHVQHEGLPEPLTLRWEP
Ligand information
>3rwd Chain C (length=11) Species: 11723 (Simian immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IRYPKTFGWLW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rwd Structural basis of diverse peptide accommodation by the rhesus macaque MHC class I molecule Mamu-B*17: insights into immune protection from simian immunodeficiency virus
Resolution2.602 Å
Binding residue
(original residue number in PDB)		Y7 Y9 S24 E45 R66 T73 N77 Y84 I95 K97 Y99 Y123 T143 K146 W147 N150 Y152 R155 F156 Y159 W167
Binding residue
(residue number reindexed from 1)		Y7 Y9 S24 E45 R66 T73 N77 Y84 I95 K97 Y99 Y123 T143 K146 W147 N150 Y152 R155 F156 Y159 W167
Enzymatic activity
Enzyme Commision number ?
External links