Structure of PDB 3rw6 Chain A Binding Site BS01

Receptor Information
>3rw6 Chain A (length=245) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NWFKITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDAS
TASALKAVNYKILDRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMS
KRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPEL
LSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKL
EELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF
Ligand information
>3rw6 Chain H (length=62) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcacuaaccuaagacaggagggccgggaaaccugccuaauccaaugacg
gguaauaguguc
.<<<<<<<<<<......<<<<<<<.<<....>>.>>>>..>>>......>
>>>..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rw6 Structure-function studies of nucleocytoplasmic transport of retroviral genomic RNA by mRNA export factor TAP.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		T123 Y126 E151 H153 Y154 R158 I190 N192 R233 V246 N248 N275 R276 Y278 K304 S305
Binding residue
(residue number reindexed from 1)		T6 Y9 E34 H36 Y37 R41 I73 N75 R116 V129 N131 N158 R159 Y161 K187 S188
Binding affinityPDBbind-CN: Kd=0.09uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006406 mRNA export from nucleus
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3rw6, PDBe:3rw6, PDBj:3rw6
PDBsum3rw6
PubMed21822283
UniProtQ9UBU9|NXF1_HUMAN Nuclear RNA export factor 1 (Gene Name=NXF1)

[Back to BioLiP]