Structure of PDB 3ruu Chain A Binding Site BS01

Receptor Information

>3ruu Chain A (length=229) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATN
HVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSG
HSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSP
DRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTF
NHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

Ligand information

>3ruu Chain B (length=11) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DHQLLRYLLDK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3ruu Conformationally constrained farnesoid X receptor (FXR) agonists: Alternative replacements of the stilbene.
Resolution	2.502 Å
Binding residue (original residue number in PDB)	K303 K321 P463 L464 E467
Binding residue (residue number reindexed from 1)	K60 K78 P220 L221 E224

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity
GO:0032052	bile acid binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0038183	bile acid signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3ruu, PDBe:3ruu, PDBj:3ruu
PDBsum	3ruu
PubMed	21890356
UniProt	Q96RI1\|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]