Structure of PDB 3rqr Chain A Binding Site BS01

Receptor Information

>3rqr Chain A (length=189) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENVDE
ELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEYDP
REGYNPQPPDLSGVTLSRELQAMAEQLAENYHNTWGRKKKQELEAKGGGT
HPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRG

Ligand information

>3rqr Chain U (length=4) Species: 9986 (Oryctolagus cuniculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3rqr Structural determination of the phosphorylation domain of the ryanodine receptor.
Resolution	2.16 Å
Binding residue (original residue number in PDB)	P2859 P2860 D2861
Binding residue (residue number reindexed from 1)	P108 P109 D110

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006816	calcium ion transport

View graph for
Biological Process

External links

PDB	RCSB:3rqr, PDBe:3rqr, PDBj:3rqr
PDBsum	3rqr
PubMed	22913516
UniProt	P11716\|RYR1_RABIT Ryanodine receptor 1 (Gene Name=RYR1)

[Back to BioLiP]