Structure of PDB 3rn2 Chain A Binding Site BS01

Receptor Information
>3rn2 Chain A (length=194) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EGFQKRCLPVMVLKAKKPFTFETQEGKQEMFHATVATEKEFFFVKVFNTL
LKDKFIPKRIIIIARYYRHSGFLEVNSASRVLDAESDQKVNVPLNIIRKA
GETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGV
RNEDTMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3rn2 Structures of the HIN Domain:DNA Complexes Reveal Ligand Binding and Activation Mechanisms of the AIM2 Inflammasome and IFI16 Receptor.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		L267 K309 R311 K340
Binding residue
(residue number reindexed from 1)		L121 K163 R165 K194
Binding affinityPDBbind-CN: Kd=0.112uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002218 activation of innate immune response
GO:0035458 cellular response to interferon-beta

View graph for
Biological Process
External links
PDB RCSB:3rn2, PDBe:3rn2, PDBj:3rn2
PDBsum3rn2
PubMed22483801
UniProtO14862|AIM2_HUMAN Interferon-inducible protein AIM2 (Gene Name=AIM2)

[Back to BioLiP]