Structure of PDB 3r9i Chain A Binding Site BS01

Receptor Information
>3r9i Chain A (length=257) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFAIGLRNLDLIMG
CERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREG
VAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVR
DSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLE
ILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEER
PFRFIEE
Ligand information
>3r9i Chain E (length=14) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NTANIAKERLQIIV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r9i The Min Oscillator Uses MinD-Dependent Conformational Changes in MinE to Spatially Regulate Cytokinesis.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		L48 E53 R54 N222 Q223 G224
Binding residue
(residue number reindexed from 1)		L47 E52 R53 N221 Q222 G223
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0042802 identical protein binding
Biological Process
GO:0000917 division septum assembly
GO:0000918 division septum site selection
GO:0007059 chromosome segregation
GO:0008298 intracellular mRNA localization
GO:0051301 cell division
GO:0051782 negative regulation of cell division
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009898 cytoplasmic side of plasma membrane
GO:0060187 cell pole

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3r9i, PDBe:3r9i, PDBj:3r9i
PDBsum3r9i
PubMed21816275
UniProtP0AEZ3|MIND_ECOLI Septum site-determining protein MinD (Gene Name=minD)

[Back to BioLiP]