Structure of PDB 3r85 Chain A Binding Site BS01

Receptor Information
>3r85 Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRYRRAFSDLT
SQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEM
QVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN
Ligand information
>3r85 Chain E (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EQLLTLASILREDGKVFDEK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r85 Structural changes in the BH3 domain of SOUL protein upon interaction with the anti-apoptotic protein Bcl-xL.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		F97 Y101 D107 L108 Q111 L112 V126 E129 L130 D133 N136 G138 R139 V141 Y195
Binding residue
(residue number reindexed from 1)		F38 Y42 D48 L49 Q52 L53 V67 E70 L71 D74 N77 G79 R80 V82 Y136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3r85, PDBe:3r85, PDBj:3r85
PDBsum3r85
PubMed21639858
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]