Structure of PDB 3r7n Chain A Binding Site BS01

Receptor Information
>3r7n Chain A (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFLEFRSGGDVDHST
LVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHG
VEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRG
VDQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r7n Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
Resolution2.33 Å
Binding residue
(original residue number in PDB)
R219 H277 Q318 C320
Binding residue
(residue number reindexed from 1)
R41 H99 Q140 C142
Enzymatic activity
Catalytic site (original residue number in PDB) E217 F218 H277 G278 C320 R321
Catalytic site (residue number reindexed from 1) E39 F40 H99 G100 C142 R143
Enzyme Commision number 3.4.22.55: caspase-2.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3r7n, PDBe:3r7n, PDBj:3r7n
PDBsum3r7n
PubMed21828056
UniProtP42575|CASP2_HUMAN Caspase-2 (Gene Name=CASP2)

[Back to BioLiP]