Structure of PDB 3r7g Chain A Binding Site BS01

Receptor Information
>3r7g Chain A (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDALSLEEILRLYNQPINEEQAWAVCYQCCGSLRAAARRRQPRHRVRSAA
QIRVWRDGAVTLAPAADQCMETEVIESLGIIIYKALDYGLKENEERELSP
PLEQLIDHMANTVEAIRSYRDVMKLCAAHLPTESDAPNHYQAVCRALFAE
TMEL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r7g Structure of the Spire KIND domain and insights into its interaction with Fmn-family formins
Resolution2.2 Å
Binding residue
(original residue number in PDB)		P52 E127 Y134 D138 E143 N144 E145 E146 R147 E148 I157 D158 A161 T163
Binding residue
(residue number reindexed from 1)		P16 E76 Y83 D87 E92 N93 E94 E95 R96 E97 I106 D107 A110 T112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0016192 vesicle-mediated transport
GO:0045010 actin nucleation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3r7g, PDBe:3r7g, PDBj:3r7g
PDBsum3r7g
PubMed
UniProtQ08AE8|SPIR1_HUMAN Protein spire homolog 1 (Gene Name=SPIRE1)

[Back to BioLiP]