Structure of PDB 3r6l Chain A Binding Site BS01

Receptor Information
>3r6l Chain A (length=155) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTLEFRSGGDVDHS
TLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSH
GVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDR
GVDQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r6l Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R219 H277 Q318 C320
Binding residue
(residue number reindexed from 1)		R42 H100 Q141 C143
Enzymatic activity
Catalytic site (original residue number in PDB) E217 F218 H277 G278 C320 R321
Catalytic site (residue number reindexed from 1) E40 F41 H100 G101 C143 R144
Enzyme Commision number 3.4.22.55: caspase-2.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3r6l, PDBe:3r6l, PDBj:3r6l
PDBsum3r6l
PubMed21828056
UniProtP42575|CASP2_HUMAN Caspase-2 (Gene Name=CASP2)

[Back to BioLiP]