Structure of PDB 3r6g Chain A Binding Site BS01

Receptor Information
>3r6g Chain A (length=157) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGELEFRSGGDVD
HSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALL
SHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDET
DRGVDQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r6g Structural and enzymatic insights into caspase-2 protein substrate recognition and catalysis.
Resolution2.07 Å
Binding residue
(original residue number in PDB)		R219 H277 Q318 C320
Binding residue
(residue number reindexed from 1)		R44 H102 Q143 C145
Enzymatic activity
Catalytic site (original residue number in PDB) E217 F218 H277 G278 C320 R321
Catalytic site (residue number reindexed from 1) E42 F43 H102 G103 C145 R146
Enzyme Commision number 3.4.22.55: caspase-2.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3r6g, PDBe:3r6g, PDBj:3r6g
PDBsum3r6g
PubMed21828056
UniProtP42575|CASP2_HUMAN Caspase-2 (Gene Name=CASP2)

[Back to BioLiP]