Structure of PDB 3r42 Chain A Binding Site BS01

Receptor Information

>3r42 Chain A (length=156) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKISVPEAVVNWLFKVIQPIYNDGRTTFHDSLALLDNFHSLRPRTRVFTH
SDGTPQLLLSIYGTISTGEDGSSPHSIPVIMWVPSMYPVKPPFISINLEN
FDMNTISSSLPIQEYIDSNGWIALPILHAWDPAAMNLIMVVQELMSLLHE
PPQDQA

Ligand information

>3r42 Chain B (length=8) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

QVPSDPYN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3r42 Structural basis for endosomal recruitment of ESCRT-I by ESCRT-0 in yeast.
Resolution	1.866 Å
Binding residue (original residue number in PDB)	V13 W16 V20 I24 R46 P47 R48 T49 L61
Binding residue (residue number reindexed from 1)	V9 W12 V16 I20 R42 P43 R44 T45 L57

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0015031	protein transport
GO:0036211	protein modification process

View graph for
Biological Process

External links

PDB	RCSB:3r42, PDBe:3r42, PDBj:3r42
PDBsum	3r42
PubMed	21505419
UniProt	P25604\|STP22_YEAST Suppressor protein STP22 of temperature-sensitive alpha-factor receptor and arginine permease (Gene Name=STP22)

[Back to BioLiP]