Structure of PDB 3r2d Chain A Binding Site BS01

Receptor Information
>3r2d Chain A (length=132) Species: 63363 (Aquifex aeolicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MMRYRKGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAKK
LVDTAVRHIEEIDSIIEKHLSIDRLGYVERNALRLGVAELIFLKSKEPGR
VFIDIVDLVKKYADEKAGKFVNGVLSAIYKAY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3r2d Structural basis for RNA recognition by NusB and NusE in the initiation of transcription antitermination.
Resolution2.199 Å
Binding residue
(original residue number in PDB)		K36 N37 I38 K39 N40 K113
Binding residue
(residue number reindexed from 1)		K37 N38 I39 K40 N41 K111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3r2d, PDBe:3r2d, PDBj:3r2d
PDBsum3r2d
PubMed21652641
UniProtO66530|NUSB_AQUAE Transcription antitermination protein NusB (Gene Name=nusB)

[Back to BioLiP]